DPCstruct | MC58324
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 67 ± 4 aa |
| Standard deviation of domain lengths | 4.46 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 48.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379VUQ9 | 3-65 | GMDGELTGLENIKLRGLFLGLSKNEIKNITEDVIEFSELGDFIKIPVRTYSSGMVLRLGFSIS |
| A0A539CRW3 | 1-57 | MSGRENVRFVARIYGQNVREVLDFVEDFSELGDYLDAPIKTYSSGMMARLAFGLSMA |
| A0A3N5B4B3 | 206-278 | None |
| A0A1Z9QR31 | 386-448 | None |
| A0A846U1Y8 | 109-171 | None |
| A0A166A1X6 | 288-358 | None |
| A0A1G5WU46 | 407-472 | None |
| A0A6N8PMC9 | 15-79 | None |
| K1XPD1 | 79-142 | None |
| A0A699J3F8 | 114-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.