DPCstruct | MC58320
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 79 ± 7 aa |
| Standard deviation of domain lengths | 6.81 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 65.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00384 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377AUI3 | 1-74 | MLAILTGNVGINGGNSGAREGSYSLPFVRMPTLENPIQTSISMFMWTDAIERGPEMTALRDGVRGKDKLDVPIK |
| A0A090R6H8 | 218-291 | MLALLTGNLGIHGGGSGARESDYNIPFVRFPTLENPVKTSISMFLWTDAIVRGPEMTATRDGVRGKDKLDVPIK |
| A0A0B8P3V6 | 397-470 | None |
| A0A644TKV1 | 399-484 | None |
| A0A0B8PBX0 | 157-229 | None |
| A0A377D3Z5 | 1-74 | None |
| A0A2X1PZQ4 | 1-74 | None |
| A0A447JHS8 | 1-92 | None |
| A0A2X3I7C1 | 37-122 | None |
| A0A0A2VYX2 | 402-489 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.