DPCstruct | MC5832
Metacluster Properties and Pfam Annotations
| Number of structural domains | 212 |
|---|---|
| Mean domain length (aa) | 131 ± 25 aa |
| Standard deviation of domain lengths | 25.19 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 15.93 |
| Pfam Score | 10.00 |
| Assigned Pfam label(s) | PF16411- CL0369- CL0159- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6AV68 | 39-157 | IKVSGGPGYFKINADLNEATYSWMKTEWGIIGSATADGWNSDQNMTYDVANKVWTATLDLVQGEIKFRANDSWDLNYGDDGADGKLD… |
| A0A7S3H2R4 | 13-139 | EDEVRFERQQVVADEPAQFFCVTGSHNDWADDRMDDGEAPGVFVYEVYMPMDGMLEFRILADGDQDKAIGPEETTESRSAALVGPGP… |
| A0A7S2JSR5 | 41-183 | None |
| A0A7S0AUI1 | 592-707 | None |
| A0A7S0AN75 | 421-569 | None |
| A0A7S0AG78 | 235-438 | None |
| A0A7S2NEJ8 | 149-291 | None |
| A0A7R9ZX08 | 16-153 | None |
| A0A6T8Y248 | 190-323 | None |
| A0A7S2LJ99 | 350-480 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.