DPCstruct | MC58313
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 92 ± 13 aa |
| Standard deviation of domain lengths | 12.72 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 42.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379VHR5 | 13-102 | AYARAALAYRYGEEHHPVTEAQVLSARRWEDKKDDLWTTFQRVQENLMKGGLNGRSAQGKRSHTRAIKGIDGDIKLNRALWVLAEQM… |
| A0A5D0WGM1 | 7-87 | THIQPSQLLNTRRTGDRENDLWTTFNVVQENAIRGGLEARFRDEHGRLRRSSSRAVKGIDQDVKLNKALWTLSEKMAELKG |
| M6JLV6 | 15-85 | None |
| H6SJP6 | 361-463 | None |
| A0A2R3Q4M4 | 230-322 | None |
| A0A850FYF4 | 12-86 | None |
| A0A2D9C583 | 32-129 | None |
| D4C0W1 | 29-129 | None |
| A0A7Y8VP67 | 92-195 | None |
| A0A6M1HSC1 | 166-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.