DPCstruct | MC5831
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 132 ± 24 aa |
| Standard deviation of domain lengths | 23.69 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 68.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2NDU6 | 1-111 | EHKEHKEHKEHKEHKEKKHNPKPEANREHHHGHRDLRRLFKQGQKYLSPPASDPTRAFYESLLQENENSKIAIRYCVEYGILSIEEH… |
| A0A7S3H2B2 | 1-151 | KKETKEKKEKKDKKEGKRDEKHRETPEELQKEFLPWEKTVKDVRAAELALQRIQWSQSEHRKIFKDGQKFPTPPVAEATRAFYESLF… |
| A0A0G4FX25 | 36-201 | None |
| A0A453A5Q3 | 27-111 | None |
| A0A2C6KDM7 | 106-284 | None |
| A0A0K9RD61 | 11-150 | None |
| Q5CTV7 | 29-192 | None |
| L0B014 | 3-158 | None |
| A0A7N2KSU3 | 50-166 | None |
| A0A7S3IA66 | 1-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.