DPCstruct | MC583
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 113 ± 11 aa |
| Standard deviation of domain lengths | 10.71 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 30.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819JVQ6 | 4-116 | QGNLSQNCWTAMVCLNKIFDHAVRMSCEQYFESSHSNAHLYNCESFTQFPIIPILQGHVRFLYRPKNILNKDFKLALISDYVCYDEQ… |
| A0A820GIR7 | 96-200 | LRGNLSDQCWIAMICLTQLANEINKISCQIWLNNDLIIEYLQTCDTIFQFPVNPIHYGHIRFLYDKPYLRLNRTSFMLPDYICFDDK… |
| A0A814VZH8 | 475-579 | None |
| A0A819A9J5 | 138-265 | None |
| A0A820ULV9 | 128-249 | None |
| A0A813T0V5 | 229-346 | None |
| A0A821HYJ4 | 306-415 | None |
| A0A813QHF1 | 318-444 | None |
| A0A813QU06 | 2-94 | None |
| A0A819BE41 | 216-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.