DPCstruct | MC58298
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 538 ± 73 aa |
| Standard deviation of domain lengths | 73.14 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 27.01 |
| Pfam Score | 95.24 |
| Assigned Pfam label(s) | CL0026- CL0159- PF18417 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A354GV08 | 6-506 | TLEIHPAIGIARVGSSQEFFLGPEPGLAIETSRRDATPSKLLKRQAARFRVYSCTRNPQGVIVSFEELTPEKATITWTVHLVNRKAA… |
| A0A7W9DL31 | 1-444 | MSLKIHPSVGVARLGNSATQICLTPETIGGLPFEADFYGNATGTIVNFKDETGLVKRQGQLFRIYQDDGAELTLNSPNVLSIIWTVH… |
| R9B1L3 | 212-742 | None |
| A0A7D5REM9 | 4-488 | None |
| A0A2Z6R9C4 | 7-592 | None |
| A0A4Q1FNN0 | 4-531 | None |
| A0A1Y5S4G9 | 345-930 | None |
| X6BZU4 | 5-574 | None |
| A0A6J7ECX7 | 41-613 | None |
| A0A0F0HWZ3 | 5-450 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.