DPCstruct | MC5829
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 179 ± 25 aa |
| Standard deviation of domain lengths | 24.65 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 16.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0717 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W7G401 | 7-149 | GAPVKNTINGVDRTGSAYAVVDPVGRFVDIGLRPGWWPALGPVRVAAALVEALEAARMQAALAPLVQRGEGRDRARSRITAAYRLID… |
| A0A4S8QJ01 | 297-488 | IEKLQARAAEGRALLASIQESRFEGRAADGAVRVVVDATGEIRKLELDPTAARLGNRELAAAIGAALAEAEEQRSENDAKILERGKS… |
| A0A4R2JJ99 | 7-206 | None |
| A0A6F8XR06 | 3-203 | None |
| A0A3P1WJW8 | 87-285 | None |
| A0A5C7M8N9 | 21-215 | None |
| A0A7X7SF64 | 9-174 | None |
| A0A100X0S0 | 39-218 | None |
| A0A7K0D7T0 | 26-162 | None |
| A0A7K0D279 | 16-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.