DPCstruct | MC58289
Metacluster Properties and Pfam Annotations
| Number of structural domains | 235 |
|---|---|
| Mean domain length (aa) | 193 ± 40 aa |
| Standard deviation of domain lengths | 40.24 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 81.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 19.89 |
| Pfam Score | 91.80 |
| Assigned Pfam label(s) | CL0344- CL0098- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R1E0T0 | 12-210 | VTVPCLQLPLRVSVLLRDGRQRSTAVHAKVLAPDCCELYDCFSHESCAAVPSFDPATTVVAFPSEGATTFADLDGLAAVDHLVLLCS… |
| F4B7Z2 | 2-142 | VRFGFAKYTEKPRGIVLNPLSEEVISIDDVEIVNKYGLSVIDSSWNKSDAKFYARFMSRFSRRLPLLFAGNPINYAKPYKLSSLEAV… |
| A0A182F5K4 | 158-366 | None |
| A0A1D2N3F8 | 267-464 | None |
| A0A6J0ZHM7 | 2-190 | None |
| A0A094K054 | 27-246 | None |
| Q5B169 | 2-181 | None |
| A0A2I3M0Z9 | 49-242 | None |
| A0A834B4C7 | 2-121 | None |
| A0A5S6QPW5 | 17-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.