DPCstruct | MC58287
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 94 ± 9 aa |
| Standard deviation of domain lengths | 9.01 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 49.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182TBH2 | 5-100 | LIDIECYRKTVKNYIDLRRYQTALFWAEKVTVLSNGEPRDVYWEAQCMFLLREFQRAAHTIRSRGLEKTNLLCHYLAAECLNEAKEY… |
| R1DRF7 | 4-86 | LAHLRYIVEDSIGKHMYENAVFLADKLVTMSRGAPDDVYLLTQAFMFTRQHRRALHVLRQHRLATSSPRFTYLTAKCLAECQE |
| A0A5J4YCD2 | 1-86 | None |
| A0A4V4H9B8 | 251-338 | None |
| A0A7J0G2T3 | 89-174 | None |
| B4DK74 | 1-111 | None |
| C7J0G8 | 16-120 | None |
| H2NKF1 | 1-110 | None |
| A0A150GN13 | 2-90 | None |
| A0A7J6I972 | 1-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.