DPCstruct | MC58285
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 108 ± 26 aa |
| Standard deviation of domain lengths | 25.82 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 88.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R1DMY2 | 32-114 | SAFFPDIDKVRYEGPSSRNPLAFKQYAEDEVVAGRTMKEWLRFSIAYWHTWRGNGGDIFGLDGTINRPWEDRALSEMDMALRR |
| A0A4U9KK69 | 9-110 | EYFKNIGQIKYEGLDSDNPLAFRWYDPSKVIAGKTMEEHFKFACAYWHSFNGDGADPFGGKTHFFPWDEKSKTIDRAKDKMDAAFEF… |
| K9IF22 | 1-81 | None |
| Q1ZW60 | 2-104 | None |
| A0A485J853 | 2-104 | None |
| A0A6A6KTF2 | 12-113 | None |
| A0A821WKT5 | 2-167 | None |
| A0A4Q2RG53 | 386-494 | None |
| A0A5S9M8Z3 | 13-118 | None |
| A0A0L7LAW3 | 2-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.