DPCstruct | MC58282
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 205 ± 29 aa |
| Standard deviation of domain lengths | 29.18 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 36.56 |
| Pfam Score | 97.37 |
| Assigned Pfam label(s) | PF02672- PF10211 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4NAJ5 | 2-158 | DVINLQEELDKRLQQRQARETGICPVREELYSQTFDELIRQVTINCAERGLLLLRVRDEIRMTIAAYQTLYESSVAFGMRKALQAEQ… |
| R1DIP6 | 162-346 | GGAVLGAGGKASLGPLSPARRKPPSSSPRLDAITLQEQLERALRERQARPTGICPVREALHGALLEELAGTIARDEPRRGTLLRRVA… |
| A0A1B1E664 | 43-248 | None |
| A0A7J6SEB4 | 58-262 | None |
| A0A835NP65 | 2-155 | None |
| A0A1A8ZRY8 | 32-200 | None |
| A0A2B4RIS8 | 249-461 | None |
| E2BMS3 | 2-150 | None |
| A4I241 | 240-460 | None |
| A0A507EKR4 | 820-1048 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.