DPCstruct | MC58281
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 248 ± 35 aa |
| Standard deviation of domain lengths | 35.30 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R1DIK0 | 5-244 | GASSFTIPRGDYHFGDTLIDIHSLVNFSVVAPGVTFWFSRGGGLRLFDCWNLRWSGSHPSAPFVIDYDPPLYAQGRVTRVGDLTSSG… |
| A0A822APR1 | 9-204 | LLLVHSSTAIFTVVSCQSFTVSSLAIDYNPLAFTAGYVMNATNSYLDVQIVPPHQADVGRQVAAIFRYNPTLMIPAFGSQTYEIYQT… |
| A0A2P6P0H9 | 300-506 | None |
| A0A7V3T7Q6 | 291-552 | None |
| A0A7C3I8I1 | 95-360 | None |
| A0A317ZHH5 | 91-315 | None |
| A0A819N9M0 | 9-212 | None |
| R7LAA4 | 201-473 | None |
| A0A522UCT2 | 21-294 | None |
| A0A821JH79 | 1-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.