DPCstruct | MC5828
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 153 ± 19 aa |
| Standard deviation of domain lengths | 18.56 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 52.85 |
| Pfam Score | 85.00 |
| Assigned Pfam label(s) | PF21384- CL0237 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W0VS18 | 1-171 | MMVIFVSQCEKKALARTRRVLDAFADRIGDKTWQTVITQEGLLAVKKLLRKTASKNTAVCCHWIRTRSKTELVWVVGRRQAFNHLGV… |
| A0A6S6SNI2 | 1-134 | MMVTFVSQCEKKALPKTRRVLDAFANRIGNRTWQTVITNEGLQAVKKLLRKTASKNTAVSCHWMKSRSRTELVWIVGNRSKFNSEGI… |
| A0A375AEK1 | 1-139 | None |
| A0A6P4AVP3 | 1-134 | None |
| A0A381H4W1 | 1-140 | None |
| G9YI68 | 1-144 | None |
| A0A165KIV1 | 1-166 | None |
| A0A1G6GT76 | 1-141 | None |
| A0A2A2B5H3 | 1-167 | None |
| A0A7Y4RWY2 | 1-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.