DPCstruct | MC58278
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 281 ± 28 aa |
| Standard deviation of domain lengths | 28.24 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 17.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R1DBC2 | 62-343 | AGLPSLSLPGSRKPGYWIAFMVLAAAVLIGASAQYAGENSSYGDYAVSVGAVGAGLGLLTLLVYRSRDSNLKKVQFELQGVGQVTNE… |
| A0A7S3Q0J9 | 4-281 | RSHSWLGLVFLSTVNIGAILDEFNYRNGQQNYALATACISLIFGTFYTSSHRIDSLRAKFVGNFIENTTAAVTLVLWAVAIAFIQSP… |
| A0A7S2PK39 | 14-314 | None |
| A0A7S2D7V1 | 4-268 | None |
| B8C343 | 66-391 | None |
| B8C0R6 | 15-307 | None |
| A9UTS7 | 27-290 | None |
| A0A7S2Q333 | 23-269 | None |
| A0A7S2U934 | 10-291 | None |
| A0A0M0JS75 | 7-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.