DPCstruct | MC5827
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 196 ± 10 aa |
| Standard deviation of domain lengths | 9.69 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 82.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J5Q7X5 | 351-544 | MVNDPKDFAIVSAVVTAANLLGLEAIGEGAETLEHLSVLAAMDCTLAQGYAIARPMPADAVATWVQTWVRPAPNLRAAAFPKEVEVA… |
| A0A0W0VP12 | 1-173 | MVAEGVETITHGKLLLQLGCNLAQGHAIAKPMPEDEIIPWVKNWKLGAEWTANRFSHAEYDEIIAAAIEHFIAYQKLERFLYDGVDQ… |
| A0A1J4Z5X2 | 556-760 | None |
| A0A522WX03 | 914-1109 | None |
| A0A7C3LPZ7 | 239-437 | None |
| C6HZT9 | 660-851 | None |
| A0A645E7F9 | 1-210 | None |
| A0A259PGL1 | 121-322 | None |
| A0A421K0R3 | 327-524 | None |
| A0A831W8V7 | 64-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.