DPCstruct | MC5826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 79 ± 13 aa |
| Standard deviation of domain lengths | 12.82 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 40.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06170 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A258H093 | 22-92 | LPRRDTWLAIRRGLRLRCPSCGKGKVLAGYLRPAERCISCGEATGEIRADDGPAWATILIVGHMVSPAFFV |
| A0A3S3UPY1 | 7-75 | TEAILRGARSRCPNCGRGALFQGYLSKVDRCAVCGEDYTRIRPADGPTFFVLCITCLLLIPAQIVTFHL |
| A0A1B3N4A0 | 62-135 | None |
| A0A2L0AFQ1 | 75-144 | None |
| D1D186 | 1-94 | None |
| A0A259JWV1 | 247-351 | None |
| A0A4P9Z172 | 4-82 | None |
| A0A2M7GSB3 | 4-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.