DPCstruct | MC58257
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 284 ± 47 aa |
| Standard deviation of domain lengths | 47.08 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.88 |
| Pfam Score | 97.62 |
| Assigned Pfam label(s) | CL0063- PF12083 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Y0IF82 | 53-348 | EDGYSYEAQTGCIPAELVDVTEDLRKAWLEQQQRGDDYVNTYQERQNARLARYIARAEKARKEGAVAHKRAHDLLDVIPLGQPILVD… |
| A0A1X7F824 | 2-248 | LTITHTREAGTLIDGTERGDGTNVVLKAHRWRWSRNLGTWYVPQSRDRAAKVRTIETTAAALREAGHDVEVTIDDTARPAAVVEADK… |
| A0A7X5HYF0 | 1-165 | None |
| A0A286FDG1 | 12-186 | None |
| A0A518KC98 | 24-403 | None |
| A0A1H3WTN7 | 511-837 | None |
| A0A6G7BUK0 | 11-294 | None |
| A0A1H2CV78 | 14-316 | None |
| A0A538QWS0 | 27-310 | None |
| Q8A4L7 | 7-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.