DPCstruct | MC58256
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 132 ± 10 aa |
| Standard deviation of domain lengths | 10.20 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 40.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Y0HME1 | 2-117 | NDVTVVTSVTYPSPESLALVADVQYHEPYLSAALNRKFRGIVDPGFYAGFLPKPGGGMNLLITSVDGDKTAGAASVDIGEFYQVTIQ… |
| A0A774SFZ1 | 2-141 | NDVTVVTSVTYPSPESLALVADVQYHEPYLSAALNRKFRGIVDPGFYAGFLPKPGGGMKLLITSVDGDKTAGAASVNIGEFYQVTIQ… |
| A0A6B8NJV8 | 1-135 | None |
| A0A0B6XGR2 | 1-132 | None |
| A0A2D5PHF1 | 1-129 | None |
| A0A827FX06 | 2-141 | None |
| A0A2X3K2U1 | 3-140 | None |
| A0A1I3SPX3 | 1-132 | None |
| A0A376YPE5 | 2-141 | None |
| A0A2X3J751 | 1-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.