DPCstruct | MC58241
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 108 ± 11 aa |
| Standard deviation of domain lengths | 11.10 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820T7L1 | 4-95 | QNSKLPVDHVLSGSYETAMRLLHDQVGIVSFEEYKQIFLQIYSRSRTAYTALPSLPALYAYPLRNWPDAHSPKLFLPAVGLKLEELV… |
| A0A7F8RQJ6 | 368-500 | TQIWCNNSQLPVDHILAGSFETAMRLLHDQVGVTQFGPYKQLFLQTYARGRTTYQALPCLPSMYSYPNRNWKDAGLKNGVPAVGLKL… |
| A0A7S1T5R3 | 59-188 | None |
| A0A6S7Q0J3 | 200-304 | None |
| A0A820BYS4 | 204-320 | None |
| A0A1U8PX65 | 1-112 | None |
| M5FYD6 | 357-464 | None |
| E4YU36 | 20-131 | None |
| A0A3P7P582 | 20-131 | None |
| A0A5J5PHC4 | 52-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.