DPCstruct | MC5824
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 62 ± 6 aa |
| Standard deviation of domain lengths | 5.71 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 78.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0364 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A455VH89 | 103-170 | DVVGTGSSRKSATNSVLWFFGDDIPYVPNKRAGGFCFGGKIAPIFFNTMEDSGALPVEMDVSKLEMGD |
| A0A447MA70 | 1-63 | MVGTGSSRKSATNSVLWFMGDDIPFVPNKRGGGLCLGGKIAPIFFNTMEDAGALPIEVGCLSP |
| A0A484YK36 | 61-116 | None |
| A0A0D9M372 | 3-59 | None |
| A0A6N6XAP1 | 56-111 | None |
| A0A378VUK4 | 92-161 | None |
| A0A812RLG3 | 187-254 | None |
| A0A7C7VM47 | 1-52 | None |
| A0A6D0F9X7 | 167-221 | None |
| A0A3S0T4M8 | 115-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.