DPCstruct | MC58221
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 72 ± 12 aa |
| Standard deviation of domain lengths | 12.30 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 35.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S1THZ3 | 1-72 | MTAEELDKKFDDGEDISDYVDWSKATRPGLALVHVDLDLPAGVLSDLDREAMRLGLTRQSLVTRWLRERLEA |
| A0A1W9H3Q7 | 1-78 | MTKQISVEEFDRLFDDGEDISDYVDWENARRPGLEPQRVEIDFPAWMVKQLDDAAEHYGVDRASLVKLWVGQRLEARG |
| A0A7Y5BJ17 | 3-72 | None |
| A0A3N5ISX7 | 1-57 | None |
| A0A0C2ZRM1 | 1-81 | None |
| A0A3N0B621 | 1-96 | None |
| A0A3E0M3K0 | 1-57 | None |
| A0A7C1HPZ2 | 1-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.