DPCstruct | MC58220
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 86 ± 9 aa |
| Standard deviation of domain lengths | 9.06 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F8QG97 | 1-108 | MFDQVLEAANMRLDPMTRGRYRLTRGLEASGGRGKRGLEIEVFDINTGKARPTATLSGGETFIAALALALGLADVVESLSGKIRMDT… |
| A0A0B0HA61 | 50-126 | FVEFIAEEQLVHVTRYASERLGELTRQRYAIELDSEGGFVIRDDANGGVRRPVTTLSGGETFLTSLSLALALSAQIQ |
| A0A7G3D626 | 57-151 | None |
| A0A4Q1JL21 | 29-111 | None |
| A0A6I1P437 | 1-95 | None |
| A0A136LAH9 | 699-775 | None |
| A0A4U3LJ67 | 466-550 | None |
| A0A3D2HT04 | 766-852 | None |
| A0A7X0RZV4 | 540-615 | None |
| A0A4P5XH61 | 80-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.