DPCstruct | MC58213
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 238 ± 63 aa |
| Standard deviation of domain lengths | 63.19 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 88.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02092 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151SVV5 | 868-1038 | VMFSRPIRWILALHGDVVVPFMFAGVTSGNLSCGLRNTSSAVVQVDGAESYSVAMKDVGINVSVEDRKKIIFEQSNALAESVNGQIL… |
| W1VNN0 | 7-169 | DDEALELDFLDIHSGRVSRGHRFLGHEVEIRHADSYEEDLRKVYVIADSIERENMIREQIKEIEAEHGVQVQIDEGLLNEVLNLVEY… |
| M4YZG3 | 2-328 | None |
| A0A0B7ML07 | 17-220 | None |
| A0A835IRZ3 | 240-397 | None |
| A0A816NH46 | 3-303 | None |
| A0A090SSJ7 | 2-146 | None |
| W0BB91 | 91-339 | None |
| A0A835RSR4 | 268-598 | None |
| A0A6A2YRW7 | 14-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.