DPCstruct | MC58210
Metacluster Properties and Pfam Annotations
| Number of structural domains | 179 |
|---|---|
| Mean domain length (aa) | 131 ± 26 aa |
| Standard deviation of domain lengths | 25.54 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.61 |
| Pfam Score | 99.17 |
| Assigned Pfam label(s) | CL0052- CL0050 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q8QPC6 | 6-118 | PGGDVQLQSMTQAFLNMHLFGMNPQEAVEAPRFATYDFPDSFEPHSRLVGRLNLEASIDQRTFAALRDMGHDVAAWSERSWRAGSVC… |
| A0A7C1QHA8 | 258-385 | IPGERGLQGPAGMIIFKDGKPFLAGGSPSRSLTQCMLQNTVNILDFGMPIDESVSRPRYGSLVDKRGITIEKNYDELVWKAVEKRGV… |
| A0A7S1EJ45 | 34-220 | None |
| A0A849IKI3 | 14-148 | None |
| A0A6A7G230 | 581-724 | None |
| A0A226EV70 | 720-863 | None |
| A0A813VKG3 | 71-220 | None |
| A0A421JPF8 | 753-896 | None |
| A0A2S4LAP6 | 282-429 | None |
| A0A318AFR8 | 2-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.