DPCstruct | MC58200
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 101 ± 18 aa |
| Standard deviation of domain lengths | 18.32 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 38.76 |
| Pfam Score | 91.26 |
| Assigned Pfam label(s) | CL0229- PF06391 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U7TEM6 | 18-109 | ECGTPLRKSNFRVQLFEDPTVDKEVEIRKKVLKIYNKREEDFPSLREYNDFLEEVEEIVFNLTNNVDLDNTKKKMEIYQKENKDVIQ… |
| W4H4J6 | 78-164 | EQDFNKDVTIRKKVLKTYNKTGEDFNSLDEYNAYLEAVEDLIFDLLSEDDAVKDAANAKWKQYKQENTLLINANEAKKAEEERRILH |
| G0P354 | 1-107 | None |
| J4H3A2 | 40-132 | None |
| A0A445D822 | 2-89 | None |
| A0A1I8FKZ0 | 31-136 | None |
| A0A5B8MFU4 | 2-78 | None |
| A0A0V1ADW8 | 2-106 | None |
| A0A4S8ING0 | 666-758 | None |
| A0A498MKR8 | 47-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.