DPCstruct | MC5820
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 164 ± 19 aa |
| Standard deviation of domain lengths | 19.35 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10139 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F9QC27 | 1-141 | MITGANRLHLQDKLSKVVFRNENAGSKRDQLAERQVFSINTEIADFIAWLDFVNQPLSQRPASRVMNERAIFENREVEKINGLPKLD… |
| A0A447M4I5 | 1-155 | MWINYLRQWARCEDNAQRLGLESPLLNAVVDILITASYRLGLPQQLQKIMQCENVSGAQLHALIGNFIAWLGYASVKEVHRPSSRIQ… |
| A0A080K8W7 | 156-352 | None |
| A4TU52 | 3-157 | None |
| A0A2X3J8N4 | 3-184 | None |
| K8CB69 | 148-299 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.