DPCstruct | MC582
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 132 ± 13 aa |
| Standard deviation of domain lengths | 13.08 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 67.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820LI72 | 70-203 | VSSRSFLPFLDNEDQFLHMRIALSGQPSRQQSQVEMRIASLTTNNEHLIEELDKKQEITIQEKKKPNEFQNKLIIHYTREKRFNTRK… |
| A0A819JPE8 | 2-127 | GQPTSRQSQVEARITQSKDDNGQYPAEQPLSATIPRLPTTTTEQGTKTKFQDKAIIHYTHEKRFTTTKKDMHEIFRKAFKCLAIEAL… |
| A0A818H6L4 | 9-127 | None |
| A0A820XIX0 | 81-225 | None |
| A0A815T2L0 | 171-286 | None |
| A0A821JD50 | 7-130 | None |
| A0A814SGX1 | 3-116 | None |
| A0A817M0W1 | 6-151 | None |
| A0A819ZSJ6 | 128-262 | None |
| A0A819XT97 | 6-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.