DPCstruct | MC58199
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 133 ± 25 aa |
| Standard deviation of domain lengths | 24.77 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 44.51 |
| Pfam Score | 90.11 |
| Assigned Pfam label(s) | PF00010- PF12533 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U7T6S9 | 1-129 | PKKRGPKKRKMTKARLERSKLRRQKANARERNRMHDLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKRPDLVS… |
| A0A384C0U8 | 78-185 | RGPKKRKMTKARLERSKLRRQKANARERNRMHDLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKRPDLVSYVQ… |
| A0A0R3U891 | 27-184 | None |
| A0A0N4ZMV9 | 1-134 | None |
| A0A2T7P936 | 2-161 | None |
| G0NHZ9 | 53-177 | None |
| A0A0D6LYR4 | 5-99 | None |
| A0A4W3H617 | 60-227 | None |
| A0A095BVU4 | 44-173 | None |
| B7Q4U8 | 4-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.