DPCstruct | MC5819
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 147 ± 11 aa |
| Standard deviation of domain lengths | 10.95 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08411 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D0F0Q7 | 211-373 | HRNKHKLMALIDVPQMKPLVHVSGMFGAWRGNTSWVAPLAWHPENRNAVIMVDLAGDISPLLELDSDTLRERLYTAKTDLGDNAAIP… |
| A0A447M2F5 | 1-126 | MFGAWRGNTSWVAPLAWHPDNRNAVIMVDLAGDISPLLELDSNALRERLYTAKADLGDNAAVPVKLVHINKCPVLAQANTLRPEDAD… |
| A0A836QPU8 | 8-153 | None |
| A0A845S0Q1 | 77-230 | None |
| A0A263HCL2 | 110-252 | None |
| A0A529TR44 | 13-161 | None |
| G2ZNG5 | 496-629 | None |
| A0A376FPU7 | 3-156 | None |
| A0A251WPH8 | 1-150 | None |
| A0A378N6D1 | 71-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.