DPCstruct | MC58182
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 182 ± 29 aa |
| Standard deviation of domain lengths | 29.42 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0181 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368EUC5 | 31-224 | LVFDERATAHSPAEDILGILTGTFTASLGLYLLQSSEAVTGGTAGLALLIQYASGLPFWMLFLIINLPFAVLAVWQRGWSFTIRTVI… |
| A0A0R1IX22 | 5-163 | PNKVAAGGATGIAILLYEGWSIPTSLSVFIINIIMLIFSYFHLDKMTTVKLVFGSFMLPVLLYLTPVYNIIPGNRLVSIIVGSIIFG… |
| A0A1E7XDS7 | 44-248 | None |
| G6EP05 | 14-185 | None |
| A0A838E0Q9 | 2-211 | None |
| L0F6V0 | 6-205 | None |
| T2RDF7 | 3-127 | None |
| A0A1M6UMJ1 | 10-203 | None |
| A0A1R0KU72 | 13-215 | None |
| A0A7X6ZPI3 | 9-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.