DPCstruct | MC5818
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 244 ± 54 aa |
| Standard deviation of domain lengths | 53.99 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 89.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 24.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E6L230 | 2-199 | EIVGAYRIGNSDMIFKEFGTKGFYSNTLFQFNDEFMFYLQNSIELGRSFVQPKYWGTRALDYLWYGIGAYVKANPNIKYMFGPVSIS… |
| A0A3S5D9H7 | 4-211 | GEQGYVFVLEDSETGDVGGICAIEVAVGLNDPWYNYRVGTLVHASKELNVYNALPTLFLSNDHTGSSELCTLFLDPEWRKEGNGYLL… |
| A0A150SPS0 | 4-198 | None |
| A0A437LS34 | 16-219 | None |
| A0A1B7XI83 | 4-305 | None |
| A0A328RBH4 | 5-318 | None |
| A0A2V9ESD5 | 1-217 | None |
| A0A485D5X1 | 2-192 | None |
| A0A1H3X6E6 | 25-246 | None |
| A0A1W7MAV1 | 2-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.