DPCstruct | MC58172
Metacluster Properties and Pfam Annotations
| Number of structural domains | 91 |
|---|---|
| Mean domain length (aa) | 199 ± 47 aa |
| Standard deviation of domain lengths | 46.76 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 91.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 20.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02633 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B1L3L9 | 24-225 | IALAEDASERTGVLIAPPIWYGWSPHHMVAPGTVSVRPEVLIELLYDAIRSLSRHGFRKFVLINGHRLANLPWIQIASERAQRELKV… |
| A0A068NLP2 | 8-220 | AAWEAGAAAIVPWGALEWHGDHLPLGLDGIVAESFAERLADQMEGVLLPGIWLPITTLPHPASLQIRTETFRAVLDDTLLGLAGAGV… |
| A0A1Q3LIQ4 | 1-190 | None |
| A0A7X7L8J5 | 3-132 | None |
| A0A356AVZ7 | 2-152 | None |
| A0A7C7SUA9 | 371-590 | None |
| A0A7V0W0V7 | 4-131 | None |
| A0A2E9IXD1 | 11-233 | None |
| T0EA11 | 2-151 | None |
| K2DIH8 | 2-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.