DPCstruct | MC5817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 142 ± 12 aa |
| Standard deviation of domain lengths | 12.30 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.95 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08345 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S6RPU7 | 1-131 | MPRSEETAEEYKPNQPPNESAVRSKQSSRSEQNGQSLIGGVPAALSNQPTPEPKAPIDTANDKNNPRPLNNNHNSRVDETTNYEIDR… |
| A0A3S4I808 | 13-149 | ANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPANQQNAQNTQQTSTRTNSDNAGPRSTQ… |
| A0A259S1A3 | 276-416 | None |
| A0A6I6IGS8 | 471-614 | None |
| A0A376VJB4 | 82-193 | None |
| A0A258TS93 | 262-409 | None |
| A0A6D0EIE0 | 105-253 | None |
| U3TUN4 | 59-209 | None |
| A0A0A2VSQ9 | 263-414 | None |
| A0A4U9V8U9 | 2-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.