DPCstruct | MC58162
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 101 ± 9 aa |
| Standard deviation of domain lengths | 9.38 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z0J5I8 | 4-101 | DWADLPGAGFKGDVPEFPLSDALTVEVELWADLWSKPQAAAWASLGLKYQVAAYVRAFLESTAAEASAGLKTAVLRMETELGISVAG… |
| A0A124IFI9 | 1-102 | MLPADGCTLPVPDLPLGRDWTDAERVRWDELWQSPQATQWDDSARGTVAVLVVYESAILKGEASAWMAQEARHAGEALGLTPRAMAA… |
| A0A059W3V0 | 1-112 | None |
| A0A1Q6BRV4 | 3-102 | None |
| A0A1I6JAT9 | 11-123 | None |
| A0A0Q5Q1H7 | 3-99 | None |
| D9UJW3 | 1-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.