DPCstruct | MC58160
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 93 ± 10 aa |
| Standard deviation of domain lengths | 9.62 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 93.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 45.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A101UXA5 | 7-95 | YPGSDLTSKVFKSLLNTDAYVTVNGGSEQVRSIQHWLNGRYVNRRNFFIVPCDGHYSHDVAKAMMYALQYEIGMSDDVAIGVFGPGS… |
| A0A0H3J1U4 | 110-201 | QSDAGLTTQDGITTPMIFKALLNTDAFVLISGGDSNIRTIQQNLNRDYNSIIGLIPSNGVYSKSTNVALIKALQHEEGNSADGIWGP… |
| A0A7K3RWL9 | 3-86 | None |
| A0A073KDW5 | 8-109 | None |
| A0A4R2JZZ6 | 209-296 | None |
| Q03D14 | 44-141 | None |
| A0A837P9G9 | 114-208 | None |
| A0A415YSE6 | 83-181 | None |
| A0A239FSD9 | 115-214 | None |
| A0A4Q2EJC1 | 62-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.