DPCstruct | MC5816
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 111 ± 7 aa |
| Standard deviation of domain lengths | 7.10 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 46.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U4H2P2 | 31-146 | QPSDARLWGDFLCAVFAIWVKEDANRIVVPLFEATLRAWRGESVQYANNPPGPACAGCAWLRLCGGGCPQLRLEDGSNALCEGYRQF… |
| A0A3S4FCE2 | 21-117 | LCSADWGRFLNSVFDIWVREDIQRISVRIFDETLQHWCERRKYAETPDTTLLSAECQMCSFLRFCRGGCPEHRDSRGRNRLCEGYQA… |
| A0A381FZY8 | 70-182 | None |
| A0A2X1J3S3 | 1-106 | None |
| I2B3P8 | 191-303 | None |
| A0A3S4IJ97 | 105-220 | None |
| A0A077Z957 | 158-263 | None |
| A0A378E814 | 21-128 | None |
| A0A5F1ECA7 | 60-165 | None |
| A0A850J7U8 | 140-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.