DPCstruct | MC58159
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 274 ± 48 aa |
| Standard deviation of domain lengths | 47.99 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08012 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A101UTA4 | 1-326 | MSAVHCLPASFLLQLRGLLVTPLPSATTFAARGFHQGSEADQRRLETVGLAFLSGLRTATSETDVEQLDHVLGAGVPRAHQGFAYEG… |
| A0A3C2AND0 | 2-223 | SIAKNIETVISTFQKGRSLSEQELGLDELISKLNQFEPRYRSVAFEGASMGVALQNSMETWKTYAKTSEKHSTQVHIGLGWAIAERE… |
| A0A2T0M4N0 | 2-275 | None |
| A0A6N9Q4X1 | 6-329 | None |
| A0A3A0CC55 | 38-376 | None |
| A0A2S9YVZ6 | 39-272 | None |
| A0A7R8GDR9 | 9-259 | None |
| A0A2W4QW67 | 28-251 | None |
| A0A7Y2FJQ5 | 32-249 | None |
| A0A316B0A3 | 20-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.