DPCstruct | MC58151
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 166 ± 21 aa |
| Standard deviation of domain lengths | 21.43 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 46.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7FSL1 | 92-241 | ADQNNEPESAMERKIVNDAAAYIRGLAHLRGRNADWAEKAVREAASLSSNEAIDQQVIDFLADDVTDLLQKLDGHTVNVLGVEQVLK… |
| A0A848QMG9 | 10-174 | SHKAMNDAIAYIRSLAQLRGRNAQWAEQAVRGAATLTASEAAQQHVIDFVAADVADLLAKADGRKVQVGDRDVTLQLKGGSVHEYAP… |
| A0A1W9PED2 | 108-313 | None |
| A0A7X7CRY6 | 9-174 | None |
| A0A536DBL7 | 65-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.