DPCstruct | MC5815
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 93 ± 8 aa |
| Standard deviation of domain lengths | 8.18 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 30.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B0MHC3 | 288-380 | CYPESPIYFDEPDLAGASCGVTTLVDAGSVGANDIDHFFAITRKVKTNVYSLLNIAKTGIIAQNELADMQQIEEASLQKAIADHPEF… |
| A0A7V9BGJ4 | 1-87 | MPPDSHSFRSGQTTLVDVGGAGWQNFPQFKAQVIDRSRTRVLSFINIVGSGMNGGPVEQNLTDMDAKLTAMRIRQHPELIVGVKVAH |
| A0A7Y5GFJ9 | 93-179 | None |
| A0A433Q823 | 69-165 | None |
| A0A2V9TMX8 | 1-81 | None |
| A0A7E4S150 | 469-565 | None |
| A0A1V5EER4 | 1-108 | None |
| A0A2E7D3P1 | 1-84 | None |
| U4V1M7 | 72-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.