DPCstruct | MC58146
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 113 ± 20 aa |
| Standard deviation of domain lengths | 19.95 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C4U8J8 | 2-109 | SILFWPEFTEYRKGVFLGFLFERRGVDAWFDELKGDEVAVEGVVNHVHLWDVFAPKVEAEYAVLAELAPRIAAMWRAALESTFPARR… |
| A0A4Q3HMS4 | 5-124 | YDLAVGYTFIFWPEFVVIDDYVLRQGSTEKHLREWERKGGSDRQGIEAVVNHLHIVDIHSGLKASEGQLRHLGRVLQSIYRLKLAAD… |
| A0A5Q3QH59 | 30-157 | None |
| B4VNF2 | 36-156 | None |
| A0A838VD61 | 3-84 | None |
| A0A7W7SZB3 | 22-158 | None |
| A0A7W4P1J3 | 22-173 | None |
| A0A837QPK1 | 2-97 | None |
| A0A318PMA4 | 21-137 | None |
| A0A7V9ZL47 | 27-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.