DPCstruct | MC5814
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 148 ± 19 aa |
| Standard deviation of domain lengths | 18.56 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05926 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A827B341 | 1-115 | MTMVARTEPGPAEDDITDTDDGDTRISAGAFWPDIVLRELRLAVRLPGRVTTSRLLHTATGAVAHVTRELEAWQQEQQAAGHQTLAD… |
| A0A3S4E1U5 | 1-135 | MTTVILNQPDEPQDVPGVVIPVPETGDAVIKNTFFFPDVDPKRVRELMRLEQTVSDARLRHAIRTGMAETNAELYDYRLRQTAAGFK… |
| A0A1Y6D0M6 | 4-155 | None |
| A0A4Y8GGV4 | 1-164 | None |
| A0A4Y6VUD9 | 1-147 | None |
| A0A839C2V5 | 1-169 | None |
| D4DNQ0 | 1-116 | None |
| W0HJV2 | 226-390 | None |
| J7RPW5 | 2-160 | None |
| B7MEC3 | 17-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.