DPCstruct | MC58139
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 92 ± 7 aa |
| Standard deviation of domain lengths | 6.77 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 94.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 55.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0254 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T0FXP6 | 1-88 | MFLYTYLFLTGFNYTLKDLKNFRCIHSKAPGHPEYNVSLGIEATTGPLGQGLGNAVGMAIAHKLFTNKIGGVFNHKSFIICFVGDGCL |
| A0A6D0EIQ6 | 69-157 | LLYSLLHLSGYDLPLEELKNFRQLHSKTPGHPELGYTPGVETTTGPLGQGLANAVGLAIAERTLAAQFNQPGHDIVDHFTYVFMGDG… |
| A0A402W8Y7 | 59-161 | None |
| A0A181ZHJ1 | 1-86 | None |
| A0A447QH21 | 1-88 | None |
| A0A0J7KTN0 | 119-220 | None |
| A0A1F2QF61 | 10-99 | None |
| A0A7J6YVT5 | 2-85 | None |
| A0A7C3JWQ7 | 73-174 | None |
| A0A090R249 | 1-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.