DPCstruct | MC58138
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 371 ± 74 aa |
| Standard deviation of domain lengths | 73.74 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 86.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.94 |
| Pfam Score | 73.20 |
| Assigned Pfam label(s) | PF04561- CL0410- PF04563- PF04567- PF10385 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T0BRP2 | 117-504 | ILHPNSEKFYINLYRILKSTEFSNTKNVKDYIKNLFQNSKNYDLSDTGRFRLNQKLNIYIPKQVRLVTIVDILLAVKLLIKLYSNKS… |
| A0A076VES1 | 1-284 | IRPVVASIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGFEVRDVHPSHYGRMCPIETPEGPNIGLIGSLASYGRV… |
| A0A7C0X2F9 | 2-316 | None |
| A0A6B9VA91 | 2-344 | None |
| A0A4S8I2F4 | 86-456 | None |
| Q8HTL6 | 412-818 | None |
| A0A345HH11 | 219-590 | None |
| A0A426H4V6 | 13-333 | None |
| A0A244C0W4 | 203-578 | None |
| A0A4Y7ICD5 | 21-380 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.