DPCstruct | MC58133
Metacluster Properties and Pfam Annotations
| Number of structural domains | 308 |
|---|---|
| Mean domain length (aa) | 302 ± 70 aa |
| Standard deviation of domain lengths | 70.06 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 81.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.40 |
| Mean intra-cluster sequence similarity (%) | 11.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF07596- PF11832 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y3ADH9 | 50-367 | TNHALKDLLVTELIRLQGFETIFFGVWQQNDHIFDKTLITFDREKIREEFKELVDIKPTIADSYHYLSADTIWYYWTNGIQLDSMYK… |
| A0A7L9BSQ7 | 164-549 | TFSDIERAFSFLPAATIADSRTLVRGRMDFEQLTPIQQTVMAMGGATVPQAREVFVQVQRRGLIGPGAMKLSFEHGVTPAASPTRAL… |
| A0A7Y5B8L7 | 143-514 | None |
| A0A2K1P266 | 156-358 | None |
| A0A1G3LC11 | 269-517 | None |
| A0A2I0NEH2 | 25-293 | None |
| A0A3L7PJA5 | 94-479 | None |
| A0A3L7PE78 | 278-621 | None |
| A0A2V6IZ40 | 175-456 | None |
| A0A2V6I3H6 | 33-327 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.