DPCstruct | MC58132
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 147 ± 13 aa |
| Standard deviation of domain lengths | 13.28 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A430HL45 | 1-162 | MSTHKAAEFAEQYTRAERVRLALLILPAGAAFLLAARFWFFPWLTAFAATAGCREIGGVPGVTLLFYGSFVGLPLLVALVFGAVLGR… |
| A0A6L6JM27 | 2-144 | AHIQKADPVARRKAIKSILIGLAVGAVLFLLFDGLIGNVNVWIEDNAELLVEHHYLAFLLMLIPVAPVIGFSIYLLRYAGRIVQAER… |
| A0A839LB70 | 2-156 | None |
| A0A7W7XYT3 | 21-160 | None |
| A0A380N1Z6 | 6-148 | None |
| A8FWH5 | 2-167 | None |
| A0A534AFS3 | 2-122 | None |
| G4CFC1 | 38-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.