DPCstruct | MC58128
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 154 ± 15 aa |
| Standard deviation of domain lengths | 15.20 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 72.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G7LQI3 | 1-152 | MESSEGSAPSESVGSAPSEAAPPANPAGSQEAGPSNQGPAPYPYQPDQVIGGDSVETIKRRLLSGHEANLTYEVCEFARIRAEDLFE… |
| K4D8U4 | 46-191 | GTSVDQPEPGHMPPAIQVAPRGNEAGPSNQPPRVVPYPYQLDEVIGGDSVQSIQRRLLAKYSYTPPIGIMYLAEIEAKDLFMVKVEI… |
| A0A6A5L6P5 | 180-334 | None |
| A0A699IS65 | 67-226 | None |
| A0A3S3N320 | 101-270 | None |
| A0A445G8M8 | 236-399 | None |
| A0A7J9I5N3 | 22-188 | None |
| A0A6P8C2G5 | 35-200 | None |
| A0A2K3L1Z5 | 322-467 | None |
| W9R174 | 26-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.