DPCstruct | MC5812
Metacluster Properties and Pfam Annotations
| Number of structural domains | 80 |
|---|---|
| Mean domain length (aa) | 139 ± 20 aa |
| Standard deviation of domain lengths | 20.16 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A356KYF2 | 3-131 | RIVLQHNMVEEDQLEDALDLQREILSTKGDKPSLERVLLDMGILRGKQLKGLRYAIIYYLVRKADRFYGKIATQSDICEQKWVDEAL… |
| A0A7M2YY82 | 11-163 | LIGAIFVEKGLVTAEQLERALQLQDETGERLGEIIVARFGVSRLELASVLAEQWAELERTEKAADAAAAAPPGDPSPQPAGDPEQPL… |
| A0A1V5ZJS2 | 2-118 | None |
| K9PVY9 | 8-144 | None |
| A0A7V2XTF0 | 56-220 | None |
| A0A7V2XSM9 | 13-147 | None |
| A0A7V2XSL3 | 13-149 | None |
| A0A7V2UVE9 | 14-130 | None |
| A0A7T1MH13 | 93-210 | None |
| A0A7W0F0L9 | 3-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.