DPCstruct | MC58115
Metacluster Properties and Pfam Annotations
| Number of structural domains | 194 |
|---|---|
| Mean domain length (aa) | 172 ± 33 aa |
| Standard deviation of domain lengths | 32.85 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 12.20 |
| Pfam Score | 97.62 |
| Assigned Pfam label(s) | CL0259- CL0193 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A257QKA6 | 1-142 | MVLSDTLNYNDIKKESVFTGNVVMTRGLMTLRSDTLSMHEDAAGFQYGTATVGAGKLVFVRQERPEKYEVIEARGLRAEYNGKTDEF… |
| A0A2D5DIG9 | 40-237 | VIAILLLAPLADRGEMSFVLDKNRVERAPERLQSNDALYRGIDDKGRPFALKAGSAVQRNATPGQVQLNDLSARIMLDDGPASVQAG… |
| A0A1V1P8Y5 | 11-137 | None |
| A0A524RR60 | 10-178 | None |
| A0A7X9IS17 | 275-486 | None |
| A0A1G7C1A8 | 162-326 | None |
| A0A3C1F6B1 | 220-406 | None |
| A0A7W1A5Y1 | 344-524 | None |
| A0A3C1BJ18 | 273-446 | None |
| A0A2M8D6V1 | 30-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.