DPCstruct | MC58113
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 213 ± 46 aa |
| Standard deviation of domain lengths | 46.03 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 83.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02731 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9VRA6 | 28-224 | SSHGDLIPKVAAPEGYDEDDEREATARMRAALQVIIDARLSAVQPASVRSRNGDPRFVKYRPARGSATFNSGAEERIVRVEHAQEGP… |
| A0A6B0S9K7 | 61-335 | GGAFPEIHVAQYPLDMGRKKKMSNALAIQVDAEGKIKYDAIARQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKT… |
| A0A183HQ78 | 3-159 | None |
| D3AY53 | 77-364 | None |
| A0A6D2J7Q2 | 6-155 | None |
| K8ENB1 | 51-236 | None |
| B9GIP2 | 7-147 | None |
| A0A421JWL4 | 40-244 | None |
| A0A7J8K135 | 61-319 | None |
| A0A565AVZ1 | 18-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.